Structure of PDB 3fde Chain B Binding Site BS02

Receptor Information

>3fde Chain B (length=206) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HMPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLV
LAGGYEDDVDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALN
CHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVV
KYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPEGYL
EALANK

Ligand information

>3fde Chain F (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtcagcgcatgg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3fde UHRF1, a modular multi-domain protein, regulates replication-coupled crosstalk between DNA methylation and histone modifications.
Resolution	1.41 Å
Binding residue (original residue number in PDB)	R448 H450 H455 R457 S458 N494 R496 N508
Binding residue (residue number reindexed from 1)	R32 H34 H39 R41 S42 N78 R80 N92

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

External links

PDB	RCSB:3fde, PDBe:3fde, PDBj:3fde
PDBsum	3fde
PubMed	19077538
UniProt	Q8VDF2\|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 (Gene Name=Uhrf1)

[Back to BioLiP]