Structure of PDB 3egm Chain B Binding Site BS02

Receptor Information

>3egm Chain B (length=172) Species: 85963 (Helicobacter pylori J99)

HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLF
DHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHE
QHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELI
GNENHGLYLADQYVKGIAKSRK

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 3egm Chain B Residue 169

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3egm The crystal structure of ferritin from Helicobacter pylori reveals unusual conformational changes for iron uptake.
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): H46 E50 E94 Q127 E130
• Binding residue (residue number reindexed from 1): H52 E56 E100 Q133 E136
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.16.3.2: bacterial non-heme ferritin.

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0008198 ferrous iron binding
• GO:0008199 ferric iron binding
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3egm, PDBe:3egm, PDBj:3egm
• PDBsum: 3egm
• PubMed: 19427319
• UniProt: Q9ZLI1|FTN_HELPJ Bacterial non-heme ferritin (Gene Name=ftnA)