Structure of PDB 3cz3 Chain B Binding Site BS02

Receptor Information
>3cz3 Chain B (length=56) Species: 12315 (Tomato aspermy virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHA
RQVELS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cz3 Structural Basis for siRNA Recognition by 2b, a Viral Suppressor of Non-Cell Autonomous RNA Silencing
Resolution3.23 Å
Binding residue
(original residue number in PDB)		K22 R26 K30 K34 K39 S47 W50
Binding residue
(residue number reindexed from 1)		K20 R24 K28 K32 K37 S45 W48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3cz3, PDBe:3cz3, PDBj:3cz3
PDBsum3cz3
PubMed
UniProtQ8UYT3|2B_TAV Suppressor of silencing 2b (Gene Name=ORF2b)

[Back to BioLiP]