Structure of PDB 3cyy Chain B Binding Site BS02

Receptor Information
>3cyy Chain B (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPTKVTLVKSAKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKI
NGTVTENMSLTDAKTLIERSKGKLKMVVQRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cyy Domain-swapped dimerization of ZO-1 PDZ2 generates specific and regulatory connexin43-binding sites
Resolution2.4 Å
Binding residue
(original residue number in PDB)
K209 L242
Binding residue
(residue number reindexed from 1)
K27 L60
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3cyy, PDBe:3cyy, PDBj:3cyy
PDBsum3cyy
PubMed18636092
UniProtQ07157|ZO1_HUMAN Tight junction protein ZO-1 (Gene Name=TJP1)

[Back to BioLiP]