Structure of PDB 3clc Chain B Binding Site BS02

Receptor Information
>3clc Chain B (length=77) Species: 211595 (Enterobacter sp. RFL1396) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIK
SLELIMKGLEVSDVVFFEMLIKEILKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3clc Structural analysis of the genetic switch that regulates the expression of restriction-modification genes.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R17 T23 Q24 R43
Binding residue
(residue number reindexed from 1)		R16 T22 Q23 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3clc, PDBe:3clc, PDBj:3clc
PDBsum3clc
PubMed18644840
UniProtQ8GGH0

[Back to BioLiP]