Structure of PDB 3cbb Chain B Binding Site BS02

Receptor Information
>3cbb Chain B (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKD
KRNQCRYCRLKKCFRAGMKKEAVQNERD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cbb Structural basis of natural promoter recognition by a unique nuclear receptor, HNF4alpha. Diabetes gene product.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G70 R77 H83 R100 N101 R104 R107
Binding residue
(residue number reindexed from 1)		G22 R29 H35 R52 N53 R56 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3cbb, PDBe:3cbb, PDBj:3cbb
PDBsum3cbb
PubMed18829458
UniProtP41235|HNF4A_HUMAN Hepatocyte nuclear factor 4-alpha (Gene Name=HNF4A)

[Back to BioLiP]