Structure of PDB 3aaf Chain B Binding Site BS02

Receptor Information
>3aaf Chain B (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFG
TGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKAN
TESQSLILQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3aaf Structural basis for DNA strand separation by the unconventional winged-helix domain of RecQ helicase WRN
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K976 F977 G978 R993 Y1034 F1037 M1038 K1039
Binding residue
(residue number reindexed from 1)		K21 F22 G23 R38 Y79 F82 M83 K84
Binding affinityPDBbind-CN: Kd=253nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
5.6.2.4: DNA 3'-5' helicase.
Gene Ontology
Molecular Function
GO:0043138 3'-5' DNA helicase activity
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3aaf, PDBe:3aaf, PDBj:3aaf
PDBsum3aaf
PubMed20159463
UniProtQ14191|WRN_HUMAN Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN (Gene Name=WRN)

[Back to BioLiP]