Structure of PDB 2zko Chain B Binding Site BS02

Receptor Information
>2zko Chain B (length=70) Species: 11320 (Influenza A virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTL
GLDIETATRAGKQIVERILK
Ligand information
>2zko Chain D (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agacagcauuaugcugucuuu
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zko Structural basis for dsRNA recognition by NS1 protein of influenza A virus
Resolution1.7 Å
Binding residue
(original residue number in PDB)		D2 T5 D34 R35 R38
Binding residue
(residue number reindexed from 1)		D2 T5 D34 R35 R38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2zko, PDBe:2zko, PDBj:2zko
PDBsum2zko
PubMed18813227
UniProtP03496|NS1_I34A1 Non-structural protein 1 (Gene Name=NS)

[Back to BioLiP]