Structure of PDB 2z3f Chain B Binding Site BS02

Receptor Information

>2z3f Chain B (length=160) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SIVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQ
SYDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQLSDVLGVTVILLSCA
YEDNEFVRVGYYVNNEMEGLNLQEMDDAEIKKVKVDISKVWRSILAEKPR
VTRFNIQWDN

Ligand information

>2z3f Chain T (length=5) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PTPVY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2z3f Crystal Structures of Fission Yeast Histone Chaperone Asf1 Complexed with the Hip1 B-domain or the Cac2 C Terminus
Resolution	2.7 Å
Binding residue (original residue number in PDB)	S8 V9 N10 V152
Binding residue (residue number reindexed from 1)	S7 V8 N9 V151

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006325	chromatin organization

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2z3f, PDBe:2z3f, PDBj:2z3f
PDBsum	2z3f
PubMed	18334479
UniProt	O74515\|ASF1_SCHPO Histone chaperone cia1 (Gene Name=cia1)

[Back to BioLiP]