Structure of PDB 2ypa Chain B Binding Site BS02

Receptor Information
>2ypa Chain B (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLI
LQQAVQVILGLEQQVRERNLNPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ypa Structural Basis for Lmo2-Driven Recruitment of the Scl:E47bHLH Heterodimer to Hematopoietic-Specific Transcriptional Targets.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N552 T584 K585
Binding residue
(residue number reindexed from 1)		N14 T46 K47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:2ypa, PDBe:2ypa, PDBj:2ypa
PDBsum2ypa
PubMed23831025
UniProtP15923|TFE2_HUMAN Transcription factor E2-alpha (Gene Name=TCF3)

[Back to BioLiP]