Structure of PDB 2xe0 Chain B Binding Site BS02

Receptor Information

>2xe0 Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNKEFLLYLAGFVDGDGSIIAQIKPRASNKFAHQLSLTFAVTQKTQR
RWFLDKLVDEIGVGYVYDSGSVSDYRLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLAIIEQLPSAKASPDAFLEVCTWVDQIAALNDSKTRATTSATVRAA
LD

Ligand information

>2xe0 Chain D (length=24)

tctggctgaggtacctgagaacaa

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2xe0 Molecular Basis of Engineered Meganuclease Targeting of the Endogenous Human Rag1 Locus
• Resolution: 2.31 Å
• Binding residue (original residue number in PDB): G19 D20 S22 I24 Q26 K28 R30 T46 Q47 K48 R51 R77 N136 D137 S138 A142
• Binding residue (residue number reindexed from 1): G18 D19 S21 I23 Q25 K27 R29 T45 Q46 K47 R50 R76 N135 D136 S137 A141
• Binding affinity: PDBbind-CN: Kd=69nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 11:46:19 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '2xe0', asym_id = 'B', bs = 'BS02', title = 'Molecular Basis of Engineered Meganuclease Targeting of the Endogenous Human Rag1 Locus'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='2xe0', asym_id='B', bs='BS02', title='Molecular Basis of Engineered Meganuclease Targeting of the Endogenous Human Rag1 Locus')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '2xe0', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='2xe0', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>