Structure of PDB 2wt7 Chain B Binding Site BS02

Receptor Information
>2wt7 Chain B (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQK
HHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKSEKLAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wt7 Design of a bZIP Transcription Factor with Homo/Heterodimer-Induced DNA-Binding Preference.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T245 R249 Q253 R256
Binding residue
(residue number reindexed from 1)		T32 R36 Q40 R43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wt7, PDBe:2wt7, PDBj:2wt7
PDBsum2wt7
PubMed24530283
UniProtP54841|MAFB_MOUSE Transcription factor MafB (Gene Name=Mafb)

[Back to BioLiP]