Structure of PDB 2w97 Chain B Binding Site BS02

Receptor Information
>2w97 Chain B (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPEHYIKHPLQNRWALWFFKKNLRLISKFDTVEDFWALYNHIQLSSNLMP
GCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCL
IGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERL
GLPPKIVIGYQSHADTATKTTKNRFVV
Ligand information
Ligand IDGOL
InChIInChI=1S/C3H8O3/c4-1-3(6)2-5/h3-6H,1-2H2
InChIKeyPEDCQBHIVMGVHV-UHFFFAOYSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.0C(C(CO)O)O
ACDLabs 12.01
CACTVS 3.370
OCC(O)CO
FormulaC3 H8 O3
NameGLYCEROL;
GLYCERIN;
PROPANE-1,2,3-TRIOL
ChEMBLCHEMBL692
DrugBankDB09462
ZINCZINC000000895048
PDB chain2w97 Chain B Residue 1220 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w97 Crystallization of eIF4E complexed with eIF4GI peptide and glycerol reveals distinct structural differences around the cap-binding site.
Resolution2.29 Å
Binding residue
(original residue number in PDB)
H200 T203
Binding residue
(residue number reindexed from 1)
H163 T166
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000339 RNA cap binding
GO:0000340 RNA 7-methylguanosine cap binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0031370 eukaryotic initiation factor 4G binding
GO:0098808 mRNA cap binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0001662 behavioral fear response
GO:0006406 mRNA export from nucleus
GO:0006412 translation
GO:0006413 translational initiation
GO:0006417 regulation of translation
GO:0010507 negative regulation of autophagy
GO:0017148 negative regulation of translation
GO:0019827 stem cell population maintenance
GO:0030182 neuron differentiation
GO:0045665 negative regulation of neuron differentiation
GO:0045931 positive regulation of mitotic cell cycle
GO:0051028 mRNA transport
GO:0051168 nuclear export
GO:0071549 cellular response to dexamethasone stimulus
GO:0099578 regulation of translation at postsynapse, modulating synaptic transmission
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0016281 eukaryotic translation initiation factor 4F complex
GO:0016442 RISC complex
GO:0016604 nuclear body
GO:0016607 nuclear speck
GO:0033391 chromatoid body
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2w97, PDBe:2w97, PDBj:2w97
PDBsum2w97
PubMed19440045
UniProtP06730|IF4E_HUMAN Eukaryotic translation initiation factor 4E (Gene Name=EIF4E)

[Back to BioLiP]