Structure of PDB 2w57 Chain B Binding Site BS02

Receptor Information

>2w57 Chain B (length=131) Species: 666 (Vibrio cholerae)

DNNQALKDAGLKVTLPRLKILEVLQQPECQHISAEELYKKLIDLGEEIGL
ATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEF
SDDVIEQRQKEIAAKYNVQLTNHSLYLYGKC

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 2w57 Chain B Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2w57 Crystal Structure of the Vibrio Cholerae Ferric Uptake Regulator (Fur) Reveals Insights Into Metal Co-Ordination.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): H33 E81 H88 H90
• Binding residue (residue number reindexed from 1): H31 E79 H86 H88
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900705 negative regulation of siderophore biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2w57, PDBe:2w57, PDBj:2w57
• PDBsum: 2w57
• PubMed: 19400801
• UniProt: P0C6C8|FUR_VIBCH Ferric uptake regulation protein (Gene Name=fur)