Structure of PDB 2w36 Chain B Binding Site BS02

Receptor Information
>2w36 Chain B (length=223) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDYRQLHRWDLPPEEAIKVQNELRKKIKLTPYEGEPEYVAGVALSFPGKE
EGLAVIVVLEYPSFKILEVVSERGEITFPYIPGLLAFREGPLFLKAWEKL
RTKPDVVVFDGQGLAHPRKLGIASHMGLFIEIPTIGVAKSRLYGTFKMPE
DKRCSWSYLYDGEEIIGCVIRTKEGSAPIFVSPGHLMDVESSKRLIKAFT
LPGRRIPEPTRLAHIYTQRLKKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w36 Structures of Endonuclease V with DNA Reveal Initiation of Deaminated Adenine Repair.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		E14 I17 I81
Binding residue
(residue number reindexed from 1)		E14 I17 I81
Enzymatic activity
Enzyme Commision number 3.1.21.7: deoxyribonuclease V.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003727 single-stranded RNA binding
GO:0004519 endonuclease activity
GO:0016891 RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0043737 deoxyribonuclease V activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2w36, PDBe:2w36, PDBj:2w36
PDBsum2w36
PubMed19136958
UniProtQ9X2H9|NFI_THEMA Endonuclease V (Gene Name=nfi)

[Back to BioLiP]