Structure of PDB 2voy Chain B Binding Site BS02

Receptor Information
>2voy Chain B (length=42) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YGHNELPAEEGKSLWELVIEQFEDLLVRILLLAACISFVLAW
Ligand information
>2voy Chain D (length=23) Species: 9986 (Oryctolagus cuniculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WLFFRYMAIGGYVGAATVGAAAW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2voy Structure of a Copper Pump Suggests a Regulatory Role for its Metal-Binding Domain.
Resolution18.0 Å
Binding residue
(original residue number in PDB)		W50 V53 F73 A76 W77
Binding residue
(residue number reindexed from 1)		W15 V18 F38 A41 W42
Enzymatic activity
Enzyme Commision number 7.2.2.10: P-type Ca(2+) transporter.
External links
PDB RCSB:2voy, PDBe:2voy, PDBj:2voy
PDBsum2voy
PubMed18547529
UniProtP04191|AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (Gene Name=ATP2A1)

[Back to BioLiP]