Structure of PDB 2vjv Chain B Binding Site BS02

Receptor Information

>2vjv Chain B (length=125) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEI
IEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLPT
LWTNSCFISTVGGAPLNVVKQYIEN

Ligand information

>2vjv Chain D (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaagcccctagcttttagctatgggg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2vjv Mechanism of is200/is605 Family DNA Transposases: Activation and Transposon-Directed Target Site Selection.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	K26 Y27 M78 K82 T83 K85 G86 R87 S89 R90 R93 T105 W107 T108 N109 S110
Binding residue (residue number reindexed from 1)	K21 Y22 M73 K77 T78 K80 G81 R82 S84 R85 R88 T100 W102 T103 N104 S105

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004803	transposase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006313	DNA transposition

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2vjv, PDBe:2vjv, PDBj:2vjv
PDBsum	2vjv
PubMed	18243097
UniProt	Q933Z0

[Back to BioLiP]