Structure of PDB 2v9w Chain B Binding Site BS02

Receptor Information

>2v9w Chain B (length=342) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIE

Ligand information

>2v9w Chain F (length=16)

cagcagtccttccccc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2v9w Structure and Activity of Y-Class DNA Polymerase Dpo4 from Sulfolobus Solfataricus with Templates Containing the Hydrophobic Thymine Analog 2,4-Difluorotoluene.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): F37 S40 G41 A42 G58 P60 E63 E219 A220 K243 S244 I245 R247 I248 V249 T250 R331 R332 R336
• Binding residue (residue number reindexed from 1): F37 S40 G41 A42 G58 P60 E63 E219 A220 K243 S244 I245 R247 I248 V249 T250 R331 R332 R336

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2v9w, PDBe:2v9w, PDBj:2v9w
• PDBsum: 2v9w
• PubMed: 17951245
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)