Structure of PDB 2r5z Chain B Binding Site BS02

Receptor Information

>2r5z Chain B (length=59) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN
KRIRYKKNI

Ligand information

>2r5z Chain D (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcagccgattaatcttagag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2r5z Functional specificity of a Hox protein mediated by the recognition of minor groove structure
Resolution	2.6 Å
Binding residue (original residue number in PDB)	R205 R206 N207 Y225 R253 I254 K257
Binding residue (residue number reindexed from 1)	R1 R2 N3 Y24 R52 I53 K56
Binding affinity	PDBbind-CN: Kd=8.63nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2r5z, PDBe:2r5z, PDBj:2r5z
PDBsum	2r5z
PubMed	17981120
UniProt	P40427\|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]