Structure of PDB 2r5y Chain B Binding Site BS02

Receptor Information
>2r5y Chain B (length=59) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN
KRIRYKKNI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2r5y Functional specificity of a Hox protein mediated by the recognition of minor groove structure
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R205 R206 Y225 R253 I254 K257
Binding residue
(residue number reindexed from 1)		R1 R2 Y24 R52 I53 K56
Binding affinityPDBbind-CN: Kd=10.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2r5y, PDBe:2r5y, PDBj:2r5y
PDBsum2r5y
PubMed17981120
UniProtP40427|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]