Structure of PDB 2qv1 Chain B Binding Site BS02

Receptor Information
>2qv1 Chain B (length=181) Species: 3052230 (Hepacivirus hominis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIMSTATQTFLATCING
VCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHA
VGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Ligand information
>2qv1 Chain D (length=21) Species: 63746 (Hepatitis C virus (isolate H77)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGSVVIVGRIVLSGKPAIIPA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qv1 Phenotypic and Structural Analyses of HCV NS3 Protease Val36 Variants
Resolution2.4 Å
Binding residue
(original residue number in PDB)
T1030 A1031 Y1032 A1033 Q1034 T1036 R1037 S1046 E1056 E1058 V1059 Q1060 I1061 M1062 S1063 R1088 T1089 I1090 A1091 R1135
Binding residue
(residue number reindexed from 1)
T4 A5 Y6 A7 Q8 T10 R11 S20 E30 E32 V33 Q34 I35 M36 S37 R62 T63 I64 A65 R109
Enzymatic activity
Catalytic site (original residue number in PDB) H1083 D1107 G1163 S1165
Catalytic site (residue number reindexed from 1) H57 D81 G137 S139
Enzyme Commision number 3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2qv1, PDBe:2qv1, PDBj:2qv1
PDBsum2qv1
PubMed
UniProtA1Z093

[Back to BioLiP]