Structure of PDB 2pvi Chain B Binding Site BS02

Receptor Information
>2pvi Chain B (length=156) Species: 585 (Proteus vulgaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHPDLNKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVL
PGRAGNDAVDNAGQEYELKSINIDLTKGFSTHHHMNPVIIAKARQVPWIF
AIYRGIAIEAIYRLEPKDLEFYYDKWERKWYSDGHKDINNPKIPVKYVME
HGTKIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pvi How is modification of the DNA substrate recognized by the PvuII restriction endonuclease?
Resolution1.76 Å
Binding residue
(original residue number in PDB)		Q33 Y123 K126 K130 N140 N141 P145
Binding residue
(residue number reindexed from 1)		Q32 Y122 K125 K129 N139 N140 P144
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2pvi, PDBe:2pvi, PDBj:2pvi
PDBsum2pvi
PubMed9628337
UniProtP23657|T2P2_PROHU Type II restriction enzyme PvuII (Gene Name=pvuIIR)

[Back to BioLiP]