Structure of PDB 2ost Chain B Binding Site BS02

Receptor Information
>2ost Chain B (length=148) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSTKLKGDIAQQAAIMRALKMGWGVLKPLGDRLSYDLVFDVEGILLKVQV
KSSWKSEKTGNYVVDNRRTRTNRRNIVRSPYRGNDFDFAVAYVEELELFY
VFPVDVFISYGSEIHLVETDKRQRKPRSFGYREAWHLILQKGAAQKET
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ost The restriction fold turns to the dark side: a bacterial homing endonuclease with a PD-(D/E)-XK motif.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T3 K4 K6 G7 D36 S52 W54 R68 R70 N72 R73 E113 Q123 R124
Binding residue
(residue number reindexed from 1)		T3 K4 K6 G7 D36 S52 W54 R68 R70 N72 R73 E113 Q123 R124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:2ost, PDBe:2ost, PDBj:2ost
PDBsum2ost
PubMed17410205
UniProtQ57253

[Back to BioLiP]