Structure of PDB 2oin Chain B Binding Site BS02

Receptor Information

>2oin Chain B (length=181) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCING
VCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHA
VGLFKAAVCTRGVAKAVDFIPVENLETTMRS

Ligand information

>2oin Chain D (length=21) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KGSVVIVGRIVLSGKPAIIPA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2oin Phenotypic and structural analyses of hepatitis C virus NS3 protease Arg155 variants: sensitivity to telaprevir (VX-950) and interferon alpha.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	T1030 A1031 Y1032 A1033 Q1034 T1036 R1037 S1046 E1056 E1058 V1059 I1061 V1062 S1063 R1088 T1089 I1090 R1135
Binding residue (residue number reindexed from 1)	T4 A5 Y6 A7 Q8 T10 R11 S20 E30 E32 V33 I35 V36 S37 R62 T63 I64 R109

Enzymatic activity

Catalytic site (original residue number in PDB)	H1083 D1107 G1163 S1165
Catalytic site (residue number reindexed from 1)	H57 D81 G137 S139
Enzyme Commision number	2.7.7.48: RNA-directed RNA polymerase. 3.4.21.98: hepacivirin. 3.4.22.- 3.6.1.15: nucleoside-triphosphate phosphatase. 3.6.4.13: RNA helicase.

Gene Ontology

	Molecular Function
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis
GO:0019087	transformation of host cell by virus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2oin, PDBe:2oin, PDBj:2oin
PDBsum	2oin
PubMed	17556358
UniProt	P27958\|POLG_HCV77 Genome polyprotein

[Back to BioLiP]