Structure of PDB 2og0 Chain B Binding Site BS02

Receptor Information
>2og0 Chain B (length=52) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKV
DL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2og0 Fis targets assembly of the xis nucleoprotein filament to promote excisive recombination by phage lambda.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E19 R22 R26 K36 R39 E40 Y41
Binding residue
(residue number reindexed from 1)		E19 R22 R26 K36 R39 E40 Y41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2og0, PDBe:2og0, PDBj:2og0
PDBsum2og0
PubMed17275024
UniProtP03699|VXIS_LAMBD Excisionase (Gene Name=xis)

[Back to BioLiP]