Structure of PDB 2nr0 Chain B Binding Site BS02

Receptor Information
>2nr0 Chain B (length=264) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCA
GRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDD
FHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLL
GENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRN
IVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRY
DLPKPPMGPLFLAD
Ligand information
>2nr0 Chain F (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgaggugguggaauugguagacacgcuaccuugaggugguagugccccuu
acggguucaagucccguccucg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nr0 How U38, 39, and 40 of Many tRNAs Become the Targets for Pseudouridylation by TruA.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		Y24 Q27 Q29 R58 A61 R110 F111 R126 Y140 V167 Q168 Q170 S171 R172 H201 H202 A238 T239
Binding residue
(residue number reindexed from 1)		Y18 Q21 Q23 R52 A55 R104 F105 R120 Y134 V161 Q162 Q164 S165 R166 H195 H196 A232 T233
Binding affinityPDBbind-CN: Kd=1.05uM
Enzymatic activity
Enzyme Commision number 5.4.99.12: tRNA pseudouridine(38-40) synthase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0042803 protein homodimerization activity
GO:0106029 tRNA pseudouridine synthase activity
GO:0140098 catalytic activity, acting on RNA
GO:0160147 tRNA pseudouridine(38-40) synthase activity
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0009451 RNA modification
GO:0031119 tRNA pseudouridine synthesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2nr0, PDBe:2nr0, PDBj:2nr0
PDBsum2nr0
PubMed17466622
UniProtP07649|TRUA_ECOLI tRNA pseudouridine synthase A (Gene Name=truA)

[Back to BioLiP]