Structure of PDB 2kei Chain B Binding Site BS02

Receptor Information
>2kei Chain B (length=62) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
RCAQQLAGKQSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kei Specificity and affinity of Lac repressor for the auxiliary operators O2 and O3 are explained by the structures of their protein-DNA complexes.
ResolutionN/A
Binding residue
(original residue number in PDB)		S16 Q18 R22 H29 S31 T34 L56
Binding residue
(residue number reindexed from 1)		S16 Q18 R22 H29 S31 T34 L56
Binding affinityPDBbind-CN: Kd=0.05nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2kei, PDBe:2kei, PDBj:2kei
PDBsum2kei
PubMed19450607
UniProtP03023|LACI_ECOLI Lactose operon repressor (Gene Name=lacI)

[Back to BioLiP]