Structure of PDB 2isz Chain B Binding Site BS02

Receptor Information
>2isz Chain B (length=140) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMER
DGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2isz Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis
Resolution2.403 Å
Binding residue
(original residue number in PDB)		R27 A28 R29 P39 S42
Binding residue
(residue number reindexed from 1)		R27 A28 R29 P39 S42
Binding affinityPDBbind-CN: Kd=4uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2isz, PDBe:2isz, PDBj:2isz
PDBsum2isz
PubMed17209554
UniProtP9WMH1|IDER_MYCTU Iron-dependent repressor IdeR (Gene Name=ideR)

[Back to BioLiP]