Structure of PDB 2ief Chain B Binding Site BS02

Receptor Information
>2ief Chain B (length=54) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKV
DLNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ief Structure of the cooperative Xis-DNA complex reveals a micronucleoprotein filament that regulates phage lambda intasome assembly.
Resolution2.601 Å
Binding residue
(original residue number in PDB)		G38 R39
Binding residue
(residue number reindexed from 1)		G38 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ief, PDBe:2ief, PDBj:2ief
PDBsum2ief
PubMed17287355
UniProtP03699|VXIS_LAMBD Excisionase (Gene Name=xis)

[Back to BioLiP]