Structure of PDB 2i3q Chain B Binding Site BS02

Receptor Information
>2i3q Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIAPNQSYKFKHQLSLTFVVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i3q Homing endonuclease I-CreI derivatives with novel DNA target specificities.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		D320 G321 S322 I324 Q326 N330 T346 Q347 K348 R370 V373 K398 N436 D437 S438 R441 K442
Binding residue
(residue number reindexed from 1)		D19 G20 S21 I23 Q25 N29 T45 Q46 K47 R69 V72 K97 N135 D136 S137 R140 K141
Enzymatic activity
Catalytic site (original residue number in PDB) G319 D320
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2i3q, PDBe:2i3q, PDBj:2i3q
PDBsum2i3q
PubMed16971456
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]