Structure of PDB 2ht0 Chain B Binding Site BS02

Receptor Information
>2ht0 Chain B (length=93) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGS
FSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ht0 Structure-based Analysis of HU-DNA Binding.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S4 K27 R62 N63 P64 L72 K75
Binding residue
(residue number reindexed from 1)		S4 K27 R62 N63 P64 L72 K75
Binding affinityPDBbind-CN: Kd=0.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0006310 DNA recombination
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
Cellular Component
GO:0005694 chromosome
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ht0, PDBe:2ht0, PDBj:2ht0
PDBsum2ht0
PubMed17097674
UniProtQ14F22

[Back to BioLiP]