Structure of PDB 2hot Chain B Binding Site BS02

Receptor Information
>2hot Chain B (length=58) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKN
MRAKIKKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hot Structure and properties of a re-engineered homeodomain protein-DNA interface.
Resolution2.19 Å
Binding residue
(original residue number in PDB)		K2 R3 N51
Binding residue
(residue number reindexed from 1)		K1 R2 N50
Binding affinityPDBbind-CN: Kd=1.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2hot, PDBe:2hot, PDBj:2hot
PDBsum2hot
PubMed17240973
UniProtP02836|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]