Structure of PDB 2han Chain B Binding Site BS02

Receptor Information
>2han Chain B (length=87) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACE
MDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2han Novel DNA-binding element within the C-terminal extension of the nuclear receptor DNA-binding domain.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Y17 H18 Y19 K28 R32 K58 V78 R87
Binding residue
(residue number reindexed from 1)		Y17 H18 Y19 K28 R32 K58 V78 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2han, PDBe:2han, PDBj:2han
PDBsum2han
PubMed17426125
UniProtP34021|ECR_DROME Ecdysone receptor (Gene Name=EcR)

[Back to BioLiP]