Structure of PDB 2h8r Chain B Binding Site BS02

Receptor Information
>2h8r Chain B (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREV
VDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQMRRN
RFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAH
GLGSNLVTEVRVYNWFANRRKEEAFR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h8r Structural basis of disease-causing mutations in hepatocyte nuclear factor 1beta.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		P135 Q136 R137 S148 S151 N155 R232 R235 N255 Y297 K305
Binding residue
(residue number reindexed from 1)		P46 Q47 R48 S59 S62 N66 R98 R101 N121 Y163 K171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0001889 liver development
GO:0006357 regulation of transcription by RNA polymerase II
GO:0030073 insulin secretion
GO:0031016 pancreas development
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2h8r, PDBe:2h8r, PDBj:2h8r
PDBsum2h8r
PubMed17924661
UniProtP35680|HNF1B_HUMAN Hepatocyte nuclear factor 1-beta (Gene Name=HNF1B)

[Back to BioLiP]