Structure of PDB 2gm4 Chain B Binding Site BS02

Receptor Information

>2gm4 Chain B (length=178) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASDRKGLDLLRMKV
KEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDSIDTSSAMGR
MVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMW
QQGLGASHISKTMNIARSTVYKVINESN

Ligand information

>2gm4 Chain I (length=3) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2gm4 Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	S10 R68 R119 L123 R130
Binding residue (residue number reindexed from 1)	S9 R63 R114 L118 R125

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2gm4, PDBe:2gm4, PDBj:2gm4
PDBsum	2gm4
PubMed	16807292
UniProt	P03012\|TNR1_ECOLI Transposon gamma-delta resolvase (Gene Name=tnpR)

[Back to BioLiP]