Structure of PDB 2gii Chain B Binding Site BS02

Receptor Information
>2gii Chain B (length=227) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFIKPIYQDINSILIEPFEKLVYKFLKENLSDLTFKQYEYLNDLFMKNPA
IIGHEARYKLFNSPTLLFLLSRGKAATENWSLFEEKQNDTADILLVKDQF
YELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDNKEFDLFDINYLEVD
WECVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQGFNGTREEWAKS
YLKHFVTQAEQRAISMIDKFVKPFKKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2gii Alteration of Sequence Specificity of the Type II Restriction Endonuclease HincII through an Indirect Readout Mechanism.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K93 F138 Y199 N201 A203 A204 R241 K248
Binding residue
(residue number reindexed from 1)		K74 F116 Y170 N172 A174 A175 R212 K219
Binding affinityPDBbind-CN: Kd=0.42nM
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2gii, PDBe:2gii, PDBj:2gii
PDBsum2gii
PubMed16675462
UniProtP17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]