Structure of PDB 2fld Chain B Binding Site BS02

Receptor Information
>2fld Chain B (length=163) Species: 141716 (Monomastix sp. OKE-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLQPTEAAYIAGFLDGDGSIYALLIPRPDYKDIKYQVSLAISFIQRKDKF
PYLQDIYDQLGKRGNLRKDRGDGIADYRIIGSTHLSIILPDLVPYLRIKK
KQANRILHIINLYPQAQKNPSKFLDLVKIVDDVQNLNKRADELKSTNYDR
LLEEFLKAGKIES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fld Computational redesign of endonuclease DNA binding and cleavage specificity.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G221 D222 G223 S224 Y226 L228 I249 Q250 R251 K254 R275 Q339 N342
Binding residue
(residue number reindexed from 1)		G16 D17 G18 S19 Y21 L23 I44 Q45 R46 K49 R70 Q134 N137
Enzymatic activity
Catalytic site (original residue number in PDB) G221 D222
Catalytic site (residue number reindexed from 1) G16 D17
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2fld, PDBe:2fld, PDBj:2fld
PDBsum2fld
PubMed16738662
UniProtC0JWR6

[Back to BioLiP]