Structure of PDB 2ez6 Chain B Binding Site BS02

Receptor Information

>2ez6 Chain B (length=218) Species: 63363 (Aquifex aeolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGNALVNFFIV
DLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINE
TIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDY
KTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSK
KEAEQRAAEELIKLLEES

Ligand information

>2ez6 Chain D (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaggucauucgcaagaguggccuuuau

<<<<<<<<<<<....>>>>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ez6 Structural Insight into the Mechanism of Double-Stranded RNA Processing by Ribonuclease III.
Resolution	2.05 Å
Binding residue (original residue number in PDB)	H27 V28 R97 N101 H179 H180 F184 K200 S201 K202
Binding residue (residue number reindexed from 1)	H25 V26 R95 N99 H177 H178 F182 K198 S199 K200

Enzymatic activity

Enzyme Commision number

3.1.26.3: ribonuclease III.

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003725	double-stranded RNA binding
GO:0004519	endonuclease activity
GO:0004525	ribonuclease III activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006364	rRNA processing
GO:0006396	RNA processing
GO:0006397	mRNA processing
GO:0008033	tRNA processing
GO:0010468	regulation of gene expression

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2ez6, PDBe:2ez6, PDBj:2ez6
PDBsum	2ez6
PubMed	16439209
UniProt	O67082\|RNC_AQUAE Ribonuclease 3 (Gene Name=rnc)

[Back to BioLiP]