Structure of PDB 2efw Chain B Binding Site BS02

Receptor Information
>2efw Chain B (length=115) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STGFLVKQRAFLKLYMITMTEQERLYGLKLLEVLRSEFKEIGFKPNHTEV
YRSLHELLDDGILKQIKVKKEGAKLQEVVLYQFKDYEAAKLYKKQLKVEL
DRSKKLIEKALSDNF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2efw An asymmetric structure of the Bacillus subtilis replication terminator protein in complex with DNA
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R16 H54 T55 E56 R59
Binding residue
(residue number reindexed from 1)		R9 H47 T48 E49 R52
Binding affinityPDBbind-CN: Kd=40pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006274 DNA replication termination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2efw, PDBe:2efw, PDBj:2efw
PDBsum2efw
PubMed17521668
UniProtP0CI76|RTP_BACSU Replication termination protein (Gene Name=rtp)

[Back to BioLiP]