Structure of PDB 2d5v Chain B Binding Site BS02

Receptor Information
>2d5v Chain B (length=135) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEEINTKEVAQRITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWS
KLKSGRETFRRMWKWLQEPEFQRMSALRLPRLVFTDVQRRTLHAIFKENK
RPSKELQITISQQLGLELSTVSNFFMNARRRSLDK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2d5v DNA recognition mechanism of the ONECUT homeodomain of transcription factor HNF-6
Resolution2.0 Å
Binding residue
(original residue number in PDB)		P23 Q24 Q36 G37 S40 R44 R101 L102 F104 T140 N143 N147 R151
Binding residue
(residue number reindexed from 1)		P23 Q24 Q36 G37 S40 R44 R81 L82 F84 T120 N123 N127 R131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2d5v, PDBe:2d5v, PDBj:2d5v
PDBsum2d5v
PubMed17223534
UniProtP70512|HNF6_RAT Hepatocyte nuclear factor 6 (Gene Name=Onecut1)

[Back to BioLiP]