Structure of PDB 2clb Chain B Binding Site BS02

Receptor Information

>2clb Chain B (length=167) Species: 273057 (Saccharolobus solfataricus P2)

PKVVGVEILEKSGLDIKKLVDKLVKATAAEFTTYYYYTILRMHLTGMEGE
GLKEIAEDARLEDRLHFELMTQRIYELGGGLPRDIRQLADISACSDAYLP
ENWKDPKEILKVLLEAEQCAIRTWKEVCDMTYGKDPRTYDLAQRILQEEI
EHEAWFLELLYGRPSGH

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 2clb Chain B Residue 1176

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2clb Structure of the Dps-Like Protein from Sulfolobus Solfataricus Reveals a Bacterioferritin-Like Dimetal Binding Site within a Dps-Like Dodecameric Assembly.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): D70 E124 E156 H159
• Binding residue (residue number reindexed from 1): D63 E117 E149 H152
• Annotation score: 5

Enzymatic activity

• Enzyme Commision number: 1.16.-.-

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0005506 iron ion binding
• GO:0008199 ferric iron binding
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0009295 nucleoid

External links

• PDB: RCSB:2clb, PDBe:2clb, PDBj:2clb
• PDBsum: 2clb
• PubMed: 16953567
• UniProt: P95855|DPS_SACS2 DNA protection during starvation protein (Gene Name=dps)