Structure of PDB 2c6y Chain B Binding Site BS02

Receptor Information

>2c6y Chain B (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNS
IRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKR

Ligand information

>2c6y Chain D (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atgtattgtttacaac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2c6y Crystal Structure of the Human Foxk1A-DNA Complex and its Implications on the Diverse Binding Specificity of Winged Helix/Forkhead Proteins.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	R52 H53 S56 K63 G74 S75 W77
Binding residue (residue number reindexed from 1)	R52 H53 S56 K63 G74 S75 W77

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2c6y, PDBe:2c6y, PDBj:2c6y
PDBsum	2c6y
PubMed	16624804
UniProt	Q01167\|FOXK2_HUMAN Forkhead box protein K2 (Gene Name=FOXK2)

[Back to BioLiP]