Structure of PDB 2bp3 Chain B Binding Site BS02

Receptor Information
>2bp3 Chain B (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTD
NQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bp3 The Structure of the Gpib-Filamin a Complex.
Resolution2.32 Å
Binding residue
(original residue number in PDB)		G1866 T1869 Y1871 G1872 H1942 P1944 G1945 F1948
Binding residue
(residue number reindexed from 1)		G2 T5 Y7 G8 H78 P80 G81 F84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2bp3, PDBe:2bp3, PDBj:2bp3
PDBsum2bp3
PubMed16293600
UniProtP21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]