Structure of PDB 2bjc Chain B Binding Site BS02

Receptor Information
>2bjc Chain B (length=62) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAMAELNYIPN
RCAQQLAGKQSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2bjc Altered Specificity in DNA Binding by the Lac Repressor: A Mutant Lac Headpiece that Mimics the Gal Repressor
ResolutionN/A
Binding residue
(original residue number in PDB)		V115 S116 A118 T119 H129 V130 S131 T134 L156 A157 K159 Q160
Binding residue
(residue number reindexed from 1)		V15 S16 A18 T19 H29 V30 S31 T34 L56 A57 K59 Q60
Binding affinityPDBbind-CN: Kd=0.01nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2bjc, PDBe:2bjc, PDBj:2bjc
PDBsum2bjc
PubMed16094693
UniProtP03023|LACI_ECOLI Lactose operon repressor (Gene Name=lacI)

[Back to BioLiP]