Structure of PDB 2ayg Chain B Binding Site BS02

Receptor Information
>2ayg Chain B (length=87) Species: 37122 (Human papillomavirus type 6a) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHA
IVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSMHLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ayg The recognition of local DNA conformation by the human papillomavirus type 6 E2 protein.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		S293 K297 R300 Y301 S315 T316
Binding residue
(residue number reindexed from 1)		S13 K17 R20 Y21 S36 T37
Binding affinityPDBbind-CN: Kd=2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ayg, PDBe:2ayg, PDBj:2ayg
PDBsum2ayg
PubMed16914454
UniProtQ84294|VE2_HPV6A Regulatory protein E2 (Gene Name=E2)

[Back to BioLiP]