Structure of PDB 2axz Chain B Binding Site BS02

Receptor Information

>2axz Chain B (length=305) Species: 1351 (Enterococcus faecalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKF
SERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIE
PKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFG
IDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTI
SIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKN
IDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYE
NYVAI

Ligand information

>2axz Chain I (length=8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TPPKEVTM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2axz Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	I251 D252
Binding residue (residue number reindexed from 1)	I251 D252

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0045892	negative regulation of DNA-templated transcription

	Cellular Component
GO:0017053	transcription repressor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2axz, PDBe:2axz, PDBj:2axz
PDBsum	2axz
PubMed	16339309
UniProt	Q04114

[Back to BioLiP]