Structure of PDB 2asd Chain B Binding Site BS02

Receptor Information

>2asd Chain B (length=341) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

Ligand information

>2asd Chain J (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctaacgctaccatccaacc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2asd Stepwise Translocation of Dpo4 Polymerase during Error-Free Bypass of an oxoG Lesion
Resolution	1.95 Å
Binding residue (original residue number in PDB)	V1032 S1034 F1037 S1040 G1041 A1042 G1218 A1220 R1242 K1243 S1244 G1246 R1247 I1248 T1250 L1293 R1331 R1332 R1336
Binding residue (residue number reindexed from 1)	V32 S34 F37 S40 G41 A42 G218 A220 R242 K243 S244 G246 R247 I248 T250 L293 R331 R332 R336

Enzymatic activity

Enzyme Commision number

2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003677	DNA binding
GO:0003684	damaged DNA binding
GO:0003887	DNA-directed DNA polymerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006260	DNA replication
GO:0006261	DNA-templated DNA replication
GO:0006281	DNA repair
GO:0006974	DNA damage response
GO:0042276	error-prone translesion synthesis

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2asd, PDBe:2asd, PDBj:2asd
PDBsum	2asd
PubMed	16379496
UniProt	Q97W02\|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)

[Back to BioLiP]