Structure of PDB 2aph Chain B Binding Site BS02

Receptor Information
>2aph Chain B (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VCPNIIKRSAWEARETHCPKMNLPAKYVIIIHTAGTSCTVSTDCQTVVRN
IQSFHMDTRNFCDIGYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIA
FIGYFVEKPPNAAALEAAQDLIQCAVVEGYLTPNYLLMGHSDVVNILSPG
QALYNIISTWPHFKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2aph Crystal structure of human peptidoglycan recognition protein I alpha bound to a muramyl pentapeptide from Gram-positive bacteria.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		T209 H231 N236 F237 Y242 S263 H264 Y266 G267 N269 V320 S324
Binding residue
(residue number reindexed from 1)		T33 H55 N60 F61 Y66 S87 H88 Y90 G91 N93 V144 S148
Enzymatic activity
Catalytic site (original residue number in PDB) Y242
Catalytic site (residue number reindexed from 1) Y66
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
GO:0042834 peptidoglycan binding
Biological Process
GO:0009253 peptidoglycan catabolic process
GO:0045087 innate immune response

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2aph, PDBe:2aph, PDBj:2aph
PDBsum2aph
PubMed16641493
UniProtQ96LB9|PGRP3_HUMAN Peptidoglycan recognition protein 3 (Gene Name=PGLYRP3)

[Back to BioLiP]