Structure of PDB 2acj Chain B Binding Site BS02

Receptor Information
>2acj Chain B (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQK
EAGTPPLWKIAVSTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2acj Crystal structure of a junction between B-DNA and Z-DNA reveals two extruded bases.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		H159 K187
Binding residue
(residue number reindexed from 1)		H22 K50
Enzymatic activity
Enzyme Commision number 3.5.4.37: double-stranded RNA adenine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:2acj, PDBe:2acj, PDBj:2acj
PDBsum2acj
PubMed16237447
UniProtP55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)

[Back to BioLiP]