Structure of PDB 1znj Chain B Binding Site BS02

Receptor Information
>1znj Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>1znj Chain D (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1znj Molecular Replacement: The Method and its Problems (in: Molecular Replacement. Proceedings of the Daresbury Study Weekend, 15-16 February, 1985. Compiled by P.A.Machin)
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H5 G8 S9 E13 Y16 E21 G23 F24 F25 Y26
Binding residue
(residue number reindexed from 1)		H5 G8 S9 E13 Y16 E21 G23 F24 F25 Y26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1znj, PDBe:1znj, PDBj:1znj
PDBsum1znj
PubMed
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]